PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010106869.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Moraceae; Morus
Family HB-other
Protein Properties Length: 1547aa    MW: 169819 Da    PI: 8.7551
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010106869.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox60.52.7e-191974257
                    T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
        Homeobox  2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57
                    +kR+  t++q+ +Le+++++++yp++e++ eLA++lgLte+q++ WF+ rR k+k+
  XP_010106869.1 19 KKRQLKTPSQVMALEKFYNEHKYPTEEMKSELAEELGLTEKQISGWFCHRRLKDKR 74
                    89****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.605.4E-21374IPR009057Homeodomain-like
PROSITE profilePS5007117.8311575IPR001356Homeobox domain
SMARTSM003899.5E-211779IPR001356Homeobox domain
SuperFamilySSF466891.15E-171783IPR009057Homeodomain-like
CDDcd000864.67E-191975No hitNo description
PfamPF000461.1E-161974IPR001356Homeobox domain
SuperFamilySSF507298.37E-17495571IPR011993PH domain-like
CDDcd133651.93E-29496572No hitNo description
Gene3DG3DSA:2.30.29.303.9E-27496576IPR011993PH domain-like
SuperFamilySSF509856.54E-997101101IPR009091Regulator of chromosome condensation 1/beta-lactamase-inhibitor protein II
Gene3DG3DSA:2.130.10.302.4E-1067111100IPR009091Regulator of chromosome condensation 1/beta-lactamase-inhibitor protein II
PROSITE profilePS5001211.911711772IPR000408Regulator of chromosome condensation, RCC1
PfamPF004151.6E-4711768IPR000408Regulator of chromosome condensation, RCC1
PRINTSPR006331.6E-15756769IPR000408Regulator of chromosome condensation, RCC1
PROSITE patternPS006260759769IPR000408Regulator of chromosome condensation, RCC1
PROSITE profilePS5001215.027773824IPR000408Regulator of chromosome condensation, RCC1
PfamPF004151.9E-9773821IPR000408Regulator of chromosome condensation, RCC1
PRINTSPR006331.6E-15775791IPR000408Regulator of chromosome condensation, RCC1
PfamPF004153.3E-9824876IPR000408Regulator of chromosome condensation, RCC1
PROSITE profilePS5001213.901825879IPR000408Regulator of chromosome condensation, RCC1
PRINTSPR006331.6E-15825841IPR000408Regulator of chromosome condensation, RCC1
PROSITE patternPS006260866876IPR000408Regulator of chromosome condensation, RCC1
PRINTSPR006331.6E-15866882IPR000408Regulator of chromosome condensation, RCC1
PROSITE profilePS5001212.514880931IPR000408Regulator of chromosome condensation, RCC1
PfamPF004153.9E-11880928IPR000408Regulator of chromosome condensation, RCC1
PRINTSPR006331.6E-15882896IPR000408Regulator of chromosome condensation, RCC1
PROSITE patternPS006260918928IPR000408Regulator of chromosome condensation, RCC1
PfamPF004154.4E-13943992IPR000408Regulator of chromosome condensation, RCC1
PROSITE profilePS5001215.549944995IPR000408Regulator of chromosome condensation, RCC1
PRINTSPR006331.6E-159851003IPR000408Regulator of chromosome condensation, RCC1
PfamPF004156.7E-89951044IPR000408Regulator of chromosome condensation, RCC1
PROSITE profilePS5001213.8819961047IPR000408Regulator of chromosome condensation, RCC1
PRINTSPR006331.6E-1510431064IPR000408Regulator of chromosome condensation, RCC1
PROSITE profilePS5001214.26310481099IPR000408Regulator of chromosome condensation, RCC1
PfamPF004152.0E-1310491096IPR000408Regulator of chromosome condensation, RCC1
SMARTSM000643.3E-1710981167IPR000306FYVE zinc finger
SuperFamilySSF579037.67E-1711001170IPR011011Zinc finger, FYVE/PHD-type
PfamPF013635.7E-1411001166IPR000306FYVE zinc finger
Gene3DG3DSA:3.30.40.102.0E-1611011170IPR013083Zinc finger, RING/FYVE/PHD-type
PROSITE profilePS5017811.74811041166IPR017455Zinc finger, FYVE-related
CDDcd000651.59E-1611091162No hitNo description
PfamPF137134.0E-1813571392IPR027988Transcription factor BREVIS RADIX, N-terminal domain
PfamPF166279.0E-2413981467No hitNo description
PROSITE profilePS5151435.5414741529IPR013591Brevis radix (BRX) domain
PfamPF083811.0E-2914741528IPR013591Brevis radix (BRX) domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0016874Molecular Functionligase activity
GO:0046872Molecular Functionmetal ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 1547 aa     Download sequence    Send to blast
MEESSEVHSD ENKVSQDNKK RQLKTPSQVM ALEKFYNEHK YPTEEMKSEL AEELGLTEKQ  60
ISGWFCHRRL KDKRSLKVEK CSSGRQERLS GIIQDLGSGF GQDSCGSTKH ADYRHVDPRE  120
VESRRLYDKG HDFPAADLSH ENRSHYTERV SGMDNTSSES SSSLRDGFSP TEDPHIVESS  180
RYLAQDGLVA PLNSKGARHM GYKPSGYLKV KGEIENAAIT AVKRQLGRQY REDGPPLGVE  240
FDPLPPGAFE SPIRDPVHEP YYAGIPVLSH SPDISVVKRQ PSPSTRYEVH NSKLSSRDSY  300
LQEAPGIMHG VNHQEKKHCN QLRQKSTYLD HTSNFPGRNS SLDMCDDSSY KSNRSRKMGS  360
KHGAEGMTSD SFLNHQGHYG GKIASKPSQS GLHEDDVLSP KIVQRSEHSK FKASISTRNH  420
CGTPDIEEKG VSTMMAQEDK FGGEGKAMKD VKVKMRPVSE MLVAKRVKVD FPRQENVTNS  480
SFSEMLPRKN HMKGLDESVL IWISGKEEKH LKLSHVSRII SGQRTPIFQR YPRPEKEYQS  540
FSLIYNDRSL DLICKDKDEA EVWFSGLKAL ISRSHHRKWR TESRSDGIPS EANSPRTCTR  600
RSSPLHSPFG SNDSLQKDGS DHLRLHSPYE SPPKNGLDKA LSDVILYAVP PKGFFPSDSA  660
SASVHSLSSG GSDSVHGHVK AMPVDAFRVS LSSAVSSLSQ GSGHDDGDAL GDVFIWGEGM  720
GDGVLGSGPH RVGSCFSGKI DSLLPKRLES AVVLDVQNVA CGGRHAALVT KQGEIFSWGE  780
ESGGRLGHGV DSDVLQPKLI DALSTTNIEF VACGEYHTCA VTLSGELYTW GDGTYNFGLL  840
GHGNEVSHWM PKRVNGPLEG IHVSYISCGP WHTAVVTSAG QLFTFGDGTF GVLGHGDRTS  900
VSMPREVESL KGLRTVRAAC GVWHTAAVVE VMVGNSSSSN CSSGKLFTWG DGDKGRLGHG  960
EKEARLVPTC VAALVEPNFC QVACGHSLTV ALTTSGHVYT MGSPVYGQLG NPQADGKLPT  1020
RVEGKHSKRF VEEIACGAYH VAVLTSKTEV YTWGKGANGR LGHGDIDDRN SPTLVEALKD  1080
KQVKSIACGT NFTAAICLHK WVSEIDQSMC SGCRLPFNFK RKRHNCYNCG FVFCHSCSSK  1140
KSLKASMAPN PNKPYRVCDN CFNKLRKAIE TDSSSHSVSR RGSINQGSNE FIDKEEKLDS  1200
RSRAQLARFS SMESLKQVET RSSKKNKKLE FNSSRVSPVP NGGSQWGAIK SFNPGFGSSK  1260
KFFSASVPGS RIVSRATSPI SRRPSPPRAT TPTPTLEGLT SPKIGVDNTK RTNDSLSQEV  1320
IKLRAQVENL TRQAQLQEVE LERTTKQLKE ALAIAGEETA KCKAAKEVIK SLTAQLKDMA  1380
ERLPVGAARN VKSPSLASLG SDLVGSDVSN PSVDRLNSQI LSQEPDSNGS HSQLHSNGST  1440
TTANRSSSHN KQGHSDVTTR NGTRTKDIDS RNDTEWVEQD EPGVYITLTS LPGGAKDLKR  1500
VRFSRKRFSE KQAEQWWAEN RARVYEQYNV RMIDKSSVGI GSEDLAH
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4d9s_A1e-53695109618378UVB-resistance protein UVR8
4d9s_B1e-53695109618378UVB-resistance protein UVR8
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
16877RLKDKRSLKV
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010106869.10.0E3 ubiquitin-protein ligase HERC2
TrEMBLW9RV990.0W9RV99_9R
STRINGVIT_06s0009g03550.t010.0(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G03250.12e-85HB-other family protein